PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G35740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 140aa    MW: 15062.1 Da    PI: 10.1095
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G35740.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.32.6e-1665125161
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                      e+e ++++r++kNRe+A rsR+RK+a+++eLe++v  L +eN +Lk   ++lk e+a+l +
  OPUNC02G35740.1  65 EEEERKTIRMMKNRESALRSRARKRAYVQELEKEVRRLVNENLKLKRHCKQLKTEMAALIQ 125
                      678899************************************************9998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.0E-1664126No hitNo description
PRINTSPR000411.7E-56480IPR001630cAMP response element binding (CREB) protein
SMARTSM003384.7E-1465129IPR004827Basic-leucine zipper domain
PfamPF001709.2E-1465125IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.50767123IPR004827Basic-leucine zipper domain
CDDcd147071.75E-1569123No hitNo description
SuperFamilySSF579591.18E-1269126No hitNo description
PRINTSPR000411.7E-582102IPR001630cAMP response element binding (CREB) protein
PRINTSPR000411.7E-5102119IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MAEQLGGVGS PQLSLSSCSS FLSISSAGTS AADGAPHLSL GVGGAEELDL LLQVGIGGGG  60
GGGEEEEERK TIRMMKNRES ALRSRARKRA YVQELEKEVR RLVNENLKLK RHCKQLKTEM  120
AALIQQPTNK QTSHRRSSST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0610860.0AK061086.1 Oryza sativa Japonica Group cDNA clone:006-206-G05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623884.12e-65PREDICTED: protein FD
TrEMBLA0A0E0K7E82e-96A0A0E0K7E8_ORYPU; Uncharacterized protein
STRINGBGIOSGA005293-PA6e-65(Oryza sativa Indica Group)
STRINGLOC_Os02g58670.16e-65(Oryza sativa Japonica Group)
STRINGORGLA02G0337900.16e-65(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.12e-15bZIP family protein